RetrogeneDB ID: | retro_ggor_436 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 1:128346858..128347177(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2D4 | ||
Ensembl ID: | ENSGGOG00000003378 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 77.78 % |
Parental protein coverage: | 72.79 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | NDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLL |
NDSP.QGGVFFLTIHFPTD..FKPPKVAFTTKIYHPNINSNGSIC.DIL.SQWSPALTV...L......L | |
Retrocopy | NDSPCQGGVFFLTIHFPTDCLFKPPKVAFTTKIYHPNINSNGSICFDILWSQWSPALTVKSSLVHLLTAL |
Parental | CDPNP-DDPLVPEIAHTYKADREKYNRLAREWTQKYAM |
..P.P..DPLV.EI.HTYKADRE.YNRLAR.WT.KYAM | |
Retrocopy | -HPQP>NDPLVLEIPHTYKADRENYNRLARQWTEKYAM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 28 .01 RPM |
SRP007412_cerebellum | 0 .00 RPM | 24 .62 RPM |
SRP007412_heart | 0 .00 RPM | 10 .57 RPM |
SRP007412_kidney | 0 .00 RPM | 23 .96 RPM |
SRP007412_liver | 0 .00 RPM | 17 .01 RPM |
SRP007412_testis | 0 .00 RPM | 17 .92 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000003997 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000007875 | 4 retrocopies | |
Dipodomys ordii | ENSDORG00000006888 | 5 retrocopies | |
Homo sapiens | ENSG00000078967 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000001368 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000003378 | 3 retrocopies |
retro_ggor_1843, retro_ggor_2936, retro_ggor_436 ,
|
Gorilla gorilla | ENSGGOG00000008393 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000010832 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000028073 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000011919 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000002410 | 5 retrocopies | |
Nomascus leucogenys | ENSNLEG00000003364 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000008900 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000029727 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000016722 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000003691 | 9 retrocopies | |
Tarsius syrichta | ENSTSYG00000000595 | 14 retrocopies |