RetrogeneDB ID: | retro_ggor_861 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 12:20734928..20735347(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBE2L3 | ||
| Ensembl ID: | ENSGGOG00000028073 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 79.17 % |
| Parental protein coverage: | 96.6 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | MKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHP |
| MKELEEI..CGMKNFRN.QVD.ANLLTWQGLIVPDNPPY.KGAFRI.INFPAEYPFKPPKIT.K.....P | |
| Retrocopy | MKELEEICNCGMKNFRNFQVDGANLLTWQGLIVPDNPPY-KGAFRIKINFPAEYPFKPPKITLKD--LSP |
| Parental | NIDEKG-QVCLPV-ISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTK |
| ....KG.QVCLPV.ISAENWKPATKTDQVIQSL.ALVNDPQPEHPL.ADLAE.YSKD.K.FCKNAE.... | |
| Retrocopy | KCPLKG>QVCLPV>ISAENWKPATKTDQVIQSLTALVNDPQPEHPLQADLAE*YSKDCKYFCKNAEVYRE |
| Parental | KYGE |
| ..G. | |
| Retrocopy | TGGK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 79 .94 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 76 .16 RPM |
| SRP007412_heart | 0 .06 RPM | 22 .11 RPM |
| SRP007412_kidney | 0 .04 RPM | 60 .97 RPM |
| SRP007412_liver | 0 .00 RPM | 32 .34 RPM |
| SRP007412_testis | 0 .00 RPM | 61 .33 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1094 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000015284 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000015818 | 9 retrocopies | |
| Dipodomys ordii | ENSDORG00000011406 | 1 retrocopy | |
| Equus caballus | ENSECAG00000019274 | 1 retrocopy | |
| Felis catus | ENSFCAG00000008008 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001368 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000003378 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000008393 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000010832 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000028073 | 3 retrocopies |
retro_ggor_1425, retro_ggor_861 , retro_ggor_924,
|
| Myotis lucifugus | ENSMLUG00000001547 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017665 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000038965 | 10 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000192 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000011602 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000014114 | 1 retrocopy | |
| Tetraodon nigroviridis | ENSTNIG00000010600 | 1 retrocopy | |
| Takifugu rubripes | ENSTRUG00000003392 | 1 retrocopy |