RetrogeneDB ID: | retro_ocun_1081 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 2:740444..740772(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSOCUG00000005679 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 57.52 % |
| Parental protein coverage: | 52.88 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | MEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTI-ARALPFWNEEIVPQIKEG-KRVLIAAHGNSLRGI |
| ME..H..YS.ISK...Y.D..ED.LPS...L.DT..A...PFWNE.I.PQIKEG.K..LI.A.GN.L.G. | |
| Retrocopy | MEFGHLLYS-ISKNCKYTDHPEDKLPS*GDLRDTK<ASTPPFWNEGIMPQIKEG>KWALITARGNGLQGF |
| Parental | VKHLEGLSEEAI-MELNLPTGIPIVYELDKNLKPIKPMQFLGD |
| ..HLEG.S.E.I.MELNL.T....VY..DKNL..IKPM..LGD | |
| Retrocopy | IRHLEGVSKETI>MELNLQTHSLMVYKSDKNLQSIKPMWLLGD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 183 .11 RPM |
| SRP017611_kidney | 0 .00 RPM | 100 .24 RPM |
| SRP017611_liver | 0 .00 RPM | 25 .90 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000012697 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000009062 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016575 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000006844 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000002467 | 1 retrocopy | |
| Homo sapiens | ENSG00000171314 | 12 retrocopies | |
| Gorilla gorilla | ENSGGOG00000028602 | 13 retrocopies | |
| Loxodonta africana | ENSLAFG00000015979 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000007657 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020027 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000004242 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000005679 | 5 retrocopies | |
| Pongo abelii | ENSPPYG00000002530 | 9 retrocopies | |
| Rattus norvegicus | ENSRNOG00000050585 | 7 retrocopies | |
| Tupaia belangeri | ENSTBEG00000005913 | 5 retrocopies | |
| Drosophila melanogaster | FBgn0014869 | 1 retrocopy |