RetrogeneDB ID: | retro_tbel_563 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
Coordinates: | GeneScaffold_2434:141821..142250(+) | ||
Located in intron of: | ENSTBEG00000006702 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSTBEG00000005913 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 56.67 % |
Parental protein coverage: | 70.39 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 4 |
Parental | EAQVKI-WRRSYDV-PPPME-PDHPFYSNISKDRRYADLTEDQLPSCESLKDTI-ARALPFWNEEIVPQI |
EAQ.KI.WR...DV.PP..E.P..P.Y...S.D.R.ADLT..QL.S..SLKDT..AR.LPFWN.EI.PQI | |
Retrocopy | EAQLKI>WRCFFDVLPPLVE>PAIP-YKATSVDHRCADLTQNQLGSTQSLKDTM<ARTLPFWNKEIIPQI |
Parental | -KEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAME |
.K.GK.VLI.AH..SL..IVKHLE.L.EE..MELNL...IP....L...L.......FL..EET..KAM. | |
Retrocopy | <KAGK*VLIVAHDTSLWSIVKHLESLFEETMMELNLLACIPPIDNL*E-LEAHRVILFLEKEET-SKAMK |
Parental | AVAAQGKAKK |
AV..Q.KAKK | |
Retrocopy | AVVVQVKAKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000012697 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000009062 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000016575 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000006844 | 4 retrocopies | |
Echinops telfairi | ENSETEG00000002467 | 1 retrocopy | |
Homo sapiens | ENSG00000171314 | 12 retrocopies | |
Gorilla gorilla | ENSGGOG00000028602 | 13 retrocopies | |
Loxodonta africana | ENSLAFG00000015979 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000007657 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000020027 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000004242 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000005679 | 5 retrocopies | |
Pongo abelii | ENSPPYG00000002530 | 9 retrocopies | |
Rattus norvegicus | ENSRNOG00000050585 | 7 retrocopies | |
Tupaia belangeri | ENSTBEG00000004587 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000005913 | 5 retrocopies | |
Drosophila melanogaster | FBgn0014869 | 1 retrocopy |