RetrogeneDB ID: | retro_sscr_482 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 15:154126715..154127117(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSSCG00000022358 | ||
| Aliases: | None | ||
| Description: | ras-related protein Rab-28 [Source:RefSeq peptide;Acc:NP_001116647] |
| Percent Identity: | 78.36 % |
| Parental protein coverage: | 95.68 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | MSDSEEESQ-DRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQVWDI |
| .SDS.EESQ...QLKI.VLGDGTSGK.SLA.CFAQETFGKQ.K.T.GL.FFLRRITLPGN...TL.V.D. | |
| Retrocopy | LSDSKEESQHQQQLKIGVLGDGTSGKPSLAACFAQETFGKQHKWTLGLAFFLRRITLPGNWTLTLPV*DL |
| Parental | GGQTIGGKMLDKYIYGAQGILLVYDITNHQSFENLEDWYSVVKKVSEESETQPLVALVGNKSKL |
| GGQT.GGKML.K.I.GAQG.LLV.DITN.QSFEN.EDWYSVV.KVSEESETQPLVALVGNK..L | |
| Retrocopy | GGQTTGGKMLGK*ICGAQGLLLVGDITNYQSFENSEDWYSVVQKVSEESETQPLVALVGNKIDL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 3 .98 RPM |
| SRP014902_testis | 0 .00 RPM | 15 .28 RPM |
| SRP018288_heart | 0 .00 RPM | 11 .11 RPM |
| SRP018288_kidney | 0 .00 RPM | 12 .81 RPM |
| SRP018288_liver | 0 .00 RPM | 8 .00 RPM |
| SRP018288_lung | 0 .00 RPM | 13 .85 RPM |
| SRP018856_adipose | 0 .00 RPM | 7 .61 RPM |
| SRP035408_brain | 0 .00 RPM | 10 .07 RPM |
| SRP035408_liver | 0 .00 RPM | 10 .71 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009344 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001523 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000012136 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007750 | 4 retrocopies | |
| Dipodomys ordii | ENSDORG00000012378 | 1 retrocopy | |
| Homo sapiens | ENSG00000157869 | 7 retrocopies | |
| Gorilla gorilla | ENSGGOG00000024190 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006792 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000022025 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016243 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014610 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015920 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000017074 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000009274 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000022358 | 2 retrocopies |
retro_sscr_482 , retro_sscr_514,
|
| Ictidomys tridecemlineatus | ENSSTOG00000004135 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000010939 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003622 | 1 retrocopy |