RetrogeneDB ID: | retro_sscr_482 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 15:154126715..154127117(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSSSCG00000022358 | ||
Aliases: | None | ||
Description: | ras-related protein Rab-28 [Source:RefSeq peptide;Acc:NP_001116647] |
Percent Identity: | 78.36 % |
Parental protein coverage: | 95.68 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | MSDSEEESQ-DRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQVWDI |
.SDS.EESQ...QLKI.VLGDGTSGK.SLA.CFAQETFGKQ.K.T.GL.FFLRRITLPGN...TL.V.D. | |
Retrocopy | LSDSKEESQHQQQLKIGVLGDGTSGKPSLAACFAQETFGKQHKWTLGLAFFLRRITLPGNWTLTLPV*DL |
Parental | GGQTIGGKMLDKYIYGAQGILLVYDITNHQSFENLEDWYSVVKKVSEESETQPLVALVGNKSKL |
GGQT.GGKML.K.I.GAQG.LLV.DITN.QSFEN.EDWYSVV.KVSEESETQPLVALVGNK..L | |
Retrocopy | GGQTTGGKMLGK*ICGAQGLLLVGDITNYQSFENSEDWYSVVQKVSEESETQPLVALVGNKIDL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 3 .98 RPM |
SRP014902_testis | 0 .00 RPM | 15 .28 RPM |
SRP018288_heart | 0 .00 RPM | 11 .11 RPM |
SRP018288_kidney | 0 .00 RPM | 12 .81 RPM |
SRP018288_liver | 0 .00 RPM | 8 .00 RPM |
SRP018288_lung | 0 .00 RPM | 13 .85 RPM |
SRP018856_adipose | 0 .00 RPM | 7 .61 RPM |
SRP035408_brain | 0 .00 RPM | 10 .07 RPM |
SRP035408_liver | 0 .00 RPM | 10 .71 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009344 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000001523 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000012136 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007750 | 4 retrocopies | |
Dipodomys ordii | ENSDORG00000012378 | 1 retrocopy | |
Homo sapiens | ENSG00000157869 | 7 retrocopies | |
Gorilla gorilla | ENSGGOG00000024190 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000006792 | 4 retrocopies | |
Macaca mulatta | ENSMMUG00000022025 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000016243 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014610 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000015920 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000017074 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000009274 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000022358 | 2 retrocopies |
retro_sscr_482 , retro_sscr_514,
|
Ictidomys tridecemlineatus | ENSSTOG00000004135 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000010939 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000003622 | 1 retrocopy |