RetrogeneDB ID: | retro_cfam_1495 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 32:11893827..11894063(-) | ||
Located in intron of: | ENSCAFG00000023804 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CKS2 | ||
Ensembl ID: | ENSCAFG00000002194 | ||
Aliases: | None | ||
Description: | CDC28 protein kinase regulatory subunit 2 [Source:HGNC Symbol;Acc:2000] |
Percent Identity: | 88.75 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRL-GVQQSLGWVHYMIHEPEPHILLF |
MAHKQIYYSDKYFDEHY.Y.HVMLPRELSKQV.KTHLMSEE.WRRL..VQQSLG.VHYMIHEPEPH.LLF | |
Retrocopy | MAHKQIYYSDKYFDEHYKYWHVMLPRELSKQVLKTHLMSEEAWRRL<YVQQSLGCVHYMIHEPEPHFLLF |
Parental | RRPLPKEQQK |
R.PLPKEQQK | |
Retrocopy | R*PLPKEQQK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 14 .78 RPM |
SRP017611_brain | 0 .00 RPM | 5 .00 RPM |
SRP017611_kidney | 0 .00 RPM | 13 .34 RPM |
SRP017611_liver | 0 .00 RPM | 1 .60 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000002194 | 2 retrocopies |
retro_cfam_1495 , retro_cfam_472,
|
Callithrix jacchus | ENSCJAG00000007792 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000009427 | 8 retrocopies | |
Erinaceus europaeus | ENSEEUG00000004384 | 7 retrocopies | |
Echinops telfairi | ENSETEG00000001260 | 10 retrocopies | |
Homo sapiens | ENSG00000123975 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000012534 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000008729 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000028843 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000007583 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000025843 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000021093 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000011011 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000014130 | 5 retrocopies | |
Sorex araneus | ENSSARG00000002443 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000021161 | 2 retrocopies |