RetrogeneDB ID: | retro_dnov_195 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_2495:32104..32341(-) | ||
Located in intron of: | ENSDNOG00000008892 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CKS2 | ||
Ensembl ID: | ENSDNOG00000009427 | ||
Aliases: | None | ||
Description: | CDC28 protein kinase regulatory subunit 2 [Source:HGNC Symbol;Acc:2000] |
Percent Identity: | 86.08 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFR |
.AHK.IYY.DKYFDE.YEY.HVMLPRELSK.VPKTHLMSEEEWRRLGVQ.SLGWVHYMIH.PEPHILLFR | |
Retrocopy | IAHKHIYYLDKYFDECYEYQHVMLPRELSKVVPKTHLMSEEEWRRLGVQKSLGWVHYMIHKPEPHILLFR |
Parental | RPLPKDQQK |
R..PKDQQ. | |
Retrocopy | RLFPKDQQQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 12 .64 RPM |
SRP012922_cerebellum | 0 .00 RPM | 0 .14 RPM |
SRP012922_heart | 0 .00 RPM | 0 .23 RPM |
SRP012922_kidney | 0 .00 RPM | 0 .00 RPM |
SRP012922_liver | 0 .00 RPM | 0 .62 RPM |
SRP012922_lung | 0 .00 RPM | 1 .22 RPM |
SRP012922_quadricep_muscle | 0 .17 RPM | 0 .69 RPM |
SRP012922_spleen | 0 .00 RPM | 30 .68 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000002194 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000007792 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000009427 | 8 retrocopies |
retro_dnov_1200, retro_dnov_1527, retro_dnov_195 , retro_dnov_1984, retro_dnov_2530, retro_dnov_2532, retro_dnov_585, retro_dnov_755,
|
Erinaceus europaeus | ENSEEUG00000004384 | 7 retrocopies | |
Echinops telfairi | ENSETEG00000001260 | 10 retrocopies | |
Felis catus | ENSFCAG00000022286 | 1 retrocopy | |
Homo sapiens | ENSG00000123975 | 1 retrocopy | |
Mus musculus | ENSMUSG00000062248 | 4 retrocopies | |
Ochotona princeps | ENSOPRG00000007583 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000025843 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000021093 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000014130 | 5 retrocopies | |
Sorex araneus | ENSSARG00000002443 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000000048 | 7 retrocopies |