RetrogeneDB ID: | retro_sara_213 | ||
Retrocopylocation | Organism: | Shrew (Sorex araneus) | |
Coordinates: | GeneScaffold_7361:75973..76202(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CKS2 | ||
Ensembl ID: | ENSSARG00000002443 | ||
Aliases: | None | ||
Description: | CDC28 protein kinase regulatory subunit 2 [Source:HGNC Symbol;Acc:2000] |
Percent Identity: | 80.52 % |
Parental protein coverage: | 96.2 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEE-EWRRLGVQQSLGWVHYMIHEPEPHILLFRR |
H.QIYY.DKYFD.HYE.RHVML.RELSKQV.KTHLMSEE.E..RLGVQQSL.WV.YM.H.PE.HILLFRR | |
Retrocopy | H*QIYYLDKYFDKHYECRHVMLSRELSKQVSKTHLMSEE>EEWRLGVQQSLSWVQYMVH*PESHILLFRR |
Parental | PLPKDQQ |
P.PKDQQ | |
Retrocopy | PFPKDQQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000002194 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000007792 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000009427 | 8 retrocopies | |
Erinaceus europaeus | ENSEEUG00000004384 | 7 retrocopies | |
Echinops telfairi | ENSETEG00000001260 | 10 retrocopies | |
Felis catus | ENSFCAG00000022286 | 1 retrocopy | |
Homo sapiens | ENSG00000123975 | 1 retrocopy | |
Mus musculus | ENSMUSG00000062248 | 4 retrocopies | |
Ochotona princeps | ENSOPRG00000007583 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000025843 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000021093 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000014130 | 5 retrocopies | |
Sorex araneus | ENSSARG00000002443 | 1 retrocopy |
retro_sara_213 ,
|
Sorex araneus | ENSSARG00000012383 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000000048 | 7 retrocopies |