RetrogeneDB ID: | retro_eeur_551 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | scaffold_342984:48724..48961(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CKS2 | ||
Ensembl ID: | ENSEEUG00000004384 | ||
Aliases: | None | ||
Description: | CDC28 protein kinase regulatory subunit 2 [Source:HGNC Symbol;Acc:2000] |
Percent Identity: | 78.48 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFR |
M.HKQ.YY.DK.F.EHY.Y.HV.LPRELS.QVPK..LMSEE.WRRLGVQQ.LGWVH.MI.EPEPH.LLFR | |
Retrocopy | MPHKQVYY*DKFFNEHYTYLHVILPRELSSQVPKAQLMSEEKWRRLGVQQNLGWVHSMISEPEPHLLLFR |
Parental | RPLPKDQQK |
.PLPKDQQK | |
Retrocopy | VPLPKDQQK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 4 .83 RPM |
SRP017611_kidney | 0 .00 RPM | 3 .94 RPM |
SRP017611_liver | 0 .00 RPM | 1 .93 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000002194 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000007792 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000009427 | 8 retrocopies | |
Erinaceus europaeus | ENSEEUG00000004384 | 7 retrocopies |
retro_eeur_183, retro_eeur_255, retro_eeur_293, retro_eeur_551 , retro_eeur_632, retro_eeur_639, retro_eeur_640,
|
Erinaceus europaeus | ENSEEUG00000015895 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000001260 | 10 retrocopies | |
Felis catus | ENSFCAG00000022286 | 1 retrocopy | |
Homo sapiens | ENSG00000123975 | 1 retrocopy | |
Mus musculus | ENSMUSG00000062248 | 4 retrocopies | |
Ochotona princeps | ENSOPRG00000007583 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000025843 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000021093 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000014130 | 5 retrocopies | |
Sorex araneus | ENSSARG00000002443 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000000048 | 7 retrocopies |