RetrogeneDB ID: | retro_cfam_1802 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 6:59509258..59509598(+) | ||
Located in intron of: | ENSCAFG00000020209 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RNF7 | ||
Ensembl ID: | ENSCAFG00000007694 | ||
Aliases: | LOC485693, GRK7 | ||
Description: | ring finger protein 7 [Source:HGNC Symbol;Acc:10070] |
Percent Identity: | 77.19 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MADVEDGEEPCAVSSHSGSAGSKSG-GDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENK |
MA..EDGE.PC..SSHSGS.GSKSG.G..MF.LKKWNAVAMWSWD.EC..C.I..VQVMDACLRCQA.N. | |
Retrocopy | MAYMEDGEQPCTESSHSGSSGSKSG>GNQMFCLKKWNAVAMWSWDMECNRCTISWVQVMDACLRCQAKNE |
Parental | QEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK |
QEDCVVVWGECN.SFHN.CMSLW.KQ....PLCQQDWVVQRI.K | |
Retrocopy | QEDCVVVWGECNPSFHNHCMSLWGKQDSHHPLCQQDWVVQRIAK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .04 RPM | 23 .23 RPM |
SRP017611_brain | 0 .00 RPM | 21 .75 RPM |
SRP017611_kidney | 0 .07 RPM | 20 .60 RPM |
SRP017611_liver | 0 .00 RPM | 5 .58 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000007694 | 1 retrocopy |
retro_cfam_1802 ,
|
Choloepus hoffmanni | ENSCHOG00000010742 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000001991 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000005961 | 3 retrocopies | |
Homo sapiens | ENSG00000114125 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001829 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000001353 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006648 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000021232 | 1 retrocopy | |
Mus musculus | ENSMUSG00000051234 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000004646 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000008659 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014167 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000039248 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000011663 | 5 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000014964 | 3 retrocopies | |
Tupaia belangeri | ENSTBEG00000002917 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000007778 | 5 retrocopies |