RetrogeneDB ID: | retro_ggor_1942 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 3:58980195..58980534(-) | ||
Located in intron of: | ENSGGOG00000004557 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RNF7 | ||
Ensembl ID: | ENSGGOG00000001829 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 86.73 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQ |
MADVEDGEE..AL.SHS.S.GSKSGGDKMF.LKKWN.VAMWSW.VECD.CAICRVQVMDACLRCQAENKQ | |
Retrocopy | MADVEDGEEPYALTSHSRSAGSKSGGDKMF*LKKWNVVAMWSWAVECDMCAICRVQVMDACLRCQAENKQ |
Parental | EDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK |
ED.VVV.GECNHSF.NC.MSLWVKQNNRCPLCQQDWV..RIGK | |
Retrocopy | EDSVVVLGECNHSFRNCRMSLWVKQNNRCPLCQQDWVARRIGK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 20 .91 RPM |
SRP007412_cerebellum | 0 .00 RPM | 19 .66 RPM |
SRP007412_heart | 0 .00 RPM | 18 .57 RPM |
SRP007412_kidney | 0 .00 RPM | 35 .33 RPM |
SRP007412_liver | 0 .00 RPM | 21 .58 RPM |
SRP007412_testis | 0 .10 RPM | 40 .92 RPM |
Species | RetrogeneDB ID |
---|---|
Macaca mulatta | retro_mmul_1440 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000007694 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000010742 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000001991 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000005961 | 3 retrocopies | |
Homo sapiens | ENSG00000114125 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001829 | 1 retrocopy |
retro_ggor_1942 ,
|
Microcebus murinus | ENSMICG00000001353 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006648 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000021232 | 1 retrocopy | |
Mus musculus | ENSMUSG00000051234 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000004646 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000008659 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014167 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000039248 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000011663 | 5 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000014964 | 3 retrocopies | |
Tupaia belangeri | ENSTBEG00000002917 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000007778 | 5 retrocopies |