RetrogeneDB ID: | retro_cfam_2141 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | X:30607063..30607405(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL10A | ||
Ensembl ID: | ENSCAFG00000001318 | ||
Aliases: | None | ||
Description: | Canis lupus familiaris ribosomal protein L10a (RPL10A), mRNA. [Source:RefSeq mRNA;Acc:NM_001252145] |
Percent Identity: | 69.23 % |
Parental protein coverage: | 53.46 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 0 |
Parental | SSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS-GTVRLKSTPRPKFSVCVLGD |
SSKVS.DTL.EAV.EVLH.NQ.K..K.LE.VE.QI.LKN.DPQKD..FS.GT.RL.S.P..KFS.C..G. | |
Retrocopy | SSKVSPDTL*EAVWEVLHRNQCKCWKLLEMVEQQIDLKNSDPQKDRCFSLGTIRLTSSPHLKFSICIVGN |
Parental | QQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLI |
.QH.DE.KAVDIPHMDIEAL..LNKN.K...K..K.YDAFLASESLI | |
Retrocopy | *QHYDESKAVDIPHMDIEALQTLNKN*K---K*YKSYDAFLASESLI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 184 .84 RPM |
SRP017611_brain | 0 .00 RPM | 44 .22 RPM |
SRP017611_kidney | 0 .00 RPM | 438 .62 RPM |
SRP017611_liver | 0 .00 RPM | 194 .77 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000001318 | 18 retrocopies | |
Echinops telfairi | ENSETEG00000013325 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000028140 | 10 retrocopies | |
Macropus eugenii | ENSMEUG00000005760 | 6 retrocopies | |
Myotis lucifugus | ENSMLUG00000000080 | 10 retrocopies | |
Monodelphis domestica | ENSMODG00000013766 | 2 retrocopies | |
Ornithorhynchus anatinus | ENSOANG00000014574 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000004065 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000018085 | 13 retrocopies | |
Pteropus vampyrus | ENSPVAG00000002763 | 9 retrocopies | |
Rattus norvegicus | ENSRNOG00000000505 | 4 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000002047 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000023366 | 3 retrocopies |