RetrogeneDB ID: | retro_chof_94 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
Coordinates: | GeneScaffold_1808:12941..13265(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FXN | ||
Ensembl ID: | ENSCHOG00000005107 | ||
Aliases: | None | ||
Description: | frataxin [Source:HGNC Symbol;Acc:3951] |
Percent Identity: | 71.43 % |
Parental protein coverage: | 52.86 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | LAEETLDSLT-FFEDLADKSYTFEDYDVSFGSGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYD |
....TLDSL..FFE.L..KSYTFEDYDVSFGSGVLT.KLG..L.TYVINK.TP.KQI.LSSPSSGPK.YD | |
Retrocopy | IQDKTLDSLVGFFEELVVKSYTFEDYDVSFGSGVLTVKLGRELETYVINKETPKKQISLSSPSSGPKCYD |
Parental | WTGKNWVYSHDGVSLHELLTAELTAALKTKLDLSSLAYSGKD |
.TGKNWV.SH....LHELL......ALKTKL.LSSL.YS.KD | |
Retrocopy | *TGKNWVCSHGSRFLHELL----NSALKTKLNLSSLSYSKKD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006915 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000005107 | 2 retrocopies |
retro_chof_349, retro_chof_94 ,
|
Callithrix jacchus | ENSCJAG00000001695 | 4 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000024066 | 3 retrocopies | |
Equus caballus | ENSECAG00000019174 | 1 retrocopy | |
Homo sapiens | ENSG00000165060 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000007636 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000000357 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000009619 | 2 retrocopies | |
Mus musculus | ENSMUSG00000059363 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000031105 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000015213 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000010336 | 4 retrocopies |