RetrogeneDB ID: | retro_ggor_1112 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 14:59396966..59397302(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FXN | ||
Ensembl ID: | ENSGGOG00000007636 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 83.93 % |
Parental protein coverage: | 53.33 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | LAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYD |
LAEETLDSLAE.FEDLAD.PY.FEDYDVSFGSGVLT.KLGGDLGTY.I..Q.PNKQIWLSSPSSGP..YD | |
Retrocopy | LAEETLDSLAEIFEDLADEPYAFEDYDVSFGSGVLTIKLGGDLGTYLIHRQAPNKQIWLSSPSSGPRNYD |
Parental | WTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKD |
.TGKN..YSHD.VSLHELLA.ELT..LKTKLDLSSLAYS.KD | |
Retrocopy | GTGKNCMYSHDSVSLHELLATELTEVLKTKLDLSSLAYSRKD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .90 RPM |
SRP007412_cerebellum | 0 .00 RPM | 4 .73 RPM |
SRP007412_heart | 0 .00 RPM | 3 .53 RPM |
SRP007412_kidney | 0 .00 RPM | 5 .77 RPM |
SRP007412_liver | 0 .00 RPM | 5 .54 RPM |
SRP007412_testis | 0 .00 RPM | 5 .28 RPM |
Species | RetrogeneDB ID |
---|---|
Callithrix jacchus | retro_cjac_813 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006915 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000005107 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000001695 | 4 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000024066 | 3 retrocopies | |
Equus caballus | ENSECAG00000019174 | 1 retrocopy | |
Homo sapiens | ENSG00000165060 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000007636 | 3 retrocopies |
retro_ggor_1112 , retro_ggor_2203, retro_ggor_2881,
|
Macaca mulatta | ENSMMUG00000000357 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000009619 | 2 retrocopies | |
Mus musculus | ENSMUSG00000059363 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000031105 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000015213 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000010336 | 4 retrocopies |