RetrogeneDB ID: | retro_mmul_2038 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 6:127046654..127047006(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FXN | ||
Ensembl ID: | ENSMMUG00000000357 | ||
Aliases: | None | ||
Description: | frataxin, mitochondrial [Source:RefSeq peptide;Acc:NP_001247670] |
Percent Identity: | 55.46 % |
Parental protein coverage: | 54.29 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | VYLMNLRKSGTLGHPGSLDDTTYERLAEETLDSLAEF---FEDLADKPYTFEDYDV-SFGSGVLTVKLGG |
V.LMNL.K..T.....SL...TY.RLA.E....LA.....F..L..K.YT.E..DV..FGS..L..KL.G | |
Retrocopy | VHLMNLMKMLTWCGQSSLGKATYKRLA-EMTNVLADWLFVF*KLKNKSYTVEI*DV>KFGSSILVTKLCG |
Parental | DLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDG-VSLHELL |
D.G.Y..NKQTPN.QIW.S.PS.GPK.YDW.G.NWVYSH...V.LHELL | |
Retrocopy | DRGAYRMNKQTPNNQIWFSLPSNGPKNYDWNGNNWVYSHNNCVPLHELL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 4 .48 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .62 RPM |
SRP007412_cerebellum | 0 .00 RPM | 4 .00 RPM |
SRP007412_heart | 0 .00 RPM | 9 .83 RPM |
SRP007412_kidney | 0 .00 RPM | 7 .28 RPM |
SRP007412_liver | 0 .00 RPM | 4 .79 RPM |
SRP007412_testis | 0 .00 RPM | 3 .58 RPM |
Species | RetrogeneDB ID |
---|---|
Gorilla gorilla | retro_ggor_2203 |
Equus caballus | retro_ecab_311 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006915 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000005107 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000001695 | 4 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000024066 | 3 retrocopies | |
Equus caballus | ENSECAG00000019174 | 1 retrocopy | |
Homo sapiens | ENSG00000165060 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000007636 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000000357 | 2 retrocopies |
retro_mmul_2038 , retro_mmul_826,
|
Mustela putorius furo | ENSMPUG00000009619 | 2 retrocopies | |
Mus musculus | ENSMUSG00000059363 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000031105 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000015213 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000010336 | 4 retrocopies |