RetrogeneDB ID: | retro_dnov_307 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_3465:97366..97640(-) | ||
| Located in intron of: | ENSDNOG00000007655 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FXN | ||
| Ensembl ID: | ENSDNOG00000024066 | ||
| Aliases: | None | ||
| Description: | frataxin [Source:HGNC Symbol;Acc:3951] |
| Percent Identity: | 58.33 % |
| Parental protein coverage: | 61.04 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 2 |
| Parental | ETTYERLAEETLDSLAEFFEDLADKSCTF-EDYDVSFGSGVLTIKLGGNLGTYVINKQTPNRQIWLSSPS |
| ETTY..LAEETLDSL..F..D.A.K..T..EDYDVSFG......K.G..LGT.VIN.Q.PN.QIW.SS.S | |
| Retrocopy | ETTYKGLAEETLDSLVKFLKDFAEKLYTL<EDYDVSFGMMF*QFKPGRDLGTFVIN*QVPNKQIW*SSLS |
| Parental | XXXXXYDWTGKNW-VYSHDGVSLHEL |
| .....Y..TGKNW.VYSHD...L..L | |
| Retrocopy | --SGCYYRTGKNW<VYSHDSKALFDL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 2 .14 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 4 .81 RPM |
| SRP012922_heart | 0 .00 RPM | 4 .64 RPM |
| SRP012922_kidney | 0 .00 RPM | 4 .65 RPM |
| SRP012922_liver | 0 .00 RPM | 1 .55 RPM |
| SRP012922_lung | 0 .00 RPM | 5 .04 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 3 .46 RPM |
| SRP012922_spleen | 0 .00 RPM | 6 .75 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006915 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000005107 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001695 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000024066 | 3 retrocopies |
retro_dnov_2204, retro_dnov_2317, retro_dnov_307 ,
|
| Equus caballus | ENSECAG00000019174 | 1 retrocopy | |
| Homo sapiens | ENSG00000165060 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007636 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000000357 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000009619 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000059363 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000031105 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000015213 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010336 | 4 retrocopies |