RetrogeneDB ID: | retro_dnov_1748 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_28660:11787..12022(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSDNOG00000014224 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 85. % |
Parental protein coverage: | 69.3 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | GVNVEPFWPGLFAKALANISIGSLICNVGAGGPAPAAGAAPAGGPAP-TTTAAPAEEKKVEAKKEESEES |
GVNVEPF.PGLFAKALA.IS.GSLICNVGAGGPAP.AGAAP.G.PAP..T.A.PAEEKKVE.KKEESEES | |
Retrocopy | GVNVEPF*PGLFAKALACISNGSLICNVGAGGPAPVAGAAPVGVPAP>PTVA-PAEEKKVETKKEESEES |
Parental | DDDMGFGLFD |
DDDMGFGLF. | |
Retrocopy | DDDMGFGLFN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 855 .66 RPM |
SRP012922_cerebellum | 0 .00 RPM | 408 .28 RPM |
SRP012922_heart | 0 .00 RPM | 468 .47 RPM |
SRP012922_kidney | 0 .00 RPM | 1049 .46 RPM |
SRP012922_liver | 0 .00 RPM | 483 .62 RPM |
SRP012922_lung | 0 .00 RPM | 1291 .44 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 1577 .15 RPM |
SRP012922_spleen | 0 .00 RPM | 1258 .96 RPM |