RetrogeneDB ID: | retro_cpor_1058 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_41:16553585..16553765(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCPOG00000004321 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 58.06 % |
| Parental protein coverage: | 52.63 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | VSELACIYSALILHDDEVTVTEDK-INALIKAAGVNVEPFWPGLFAKA-LANVSIGSLICNV |
| VSE..CIYSALIL.D.EV..TEDK...A...AAG.NVE.F.P.L.A.A.LA....GS.IC.. | |
| Retrocopy | VSEVVCIYSALILYDPEVMYTEDK>VSAPTGAAGINVELFQPDLSAEA<LASAIMGSCICTL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 136 .14 RPM |
| SRP017611_kidney | 0 .00 RPM | 264 .86 RPM |
| SRP017611_liver | 0 .00 RPM | 118 .09 RPM |
| SRP040447_lung | 0 .00 RPM | 344 .84 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 858 .33 RPM |