RetrogeneDB ID: | retro_dnov_1901 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_36037:8809..9133(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FAM213A | ||
Ensembl ID: | ENSDNOG00000001981 | ||
Aliases: | None | ||
Description: | family with sequence similarity 213, member A [Source:HGNC Symbol;Acc:28651] |
Percent Identity: | 60.71 % |
Parental protein coverage: | 64.88 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | EVQDFQPY-FKGEVFLDEKKEFYGP-HRRKMMLLGFVRLGVWFNFLRARNGGFSGNLEGEGFVLGGVFVV |
EVQDF.PY.FKGE.FLDEKK.F..P..R.KM...GF...G.W.......N.GFSGNL.GE.F..G.VFVV | |
Retrocopy | EVQDF*PY<FKGELFLDEKKKFTDP<QRQKMVSMGFLIWGIWCSVFHCQNRGFSGNLGGEVFIPGEVFVV |
Parental | GPGKQGILLEHREKEFGD-KVSLVSVLEAARKIEPQTSTSEK |
G.GKQG..L.HREKE.G..KV..V..LE.ARKI.PQ.S.SEK | |
Retrocopy | GSGKQGMPLQHREKECGE<KVHPVCLLEVARKIKPQNSDSEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 34 .62 RPM |
SRP012922_cerebellum | 0 .00 RPM | 15 .67 RPM |
SRP012922_heart | 0 .00 RPM | 7 .19 RPM |
SRP012922_kidney | 0 .00 RPM | 104 .86 RPM |
SRP012922_liver | 0 .00 RPM | 92 .57 RPM |
SRP012922_lung | 0 .00 RPM | 13 .44 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 5 .02 RPM |
SRP012922_spleen | 0 .00 RPM | 74 .29 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000000813 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000003657 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000001981 | 3 retrocopies |
retro_dnov_1843, retro_dnov_1901 , retro_dnov_868,
|
Homo sapiens | ENSG00000122378 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000013246 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000007485 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000021773 | 3 retrocopies | |
Mus musculus | ENSMUSG00000021792 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000013638 | 7 retrocopies | |
Procavia capensis | ENSPCAG00000009696 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000025862 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000002685 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000011140 | 1 retrocopy |