RetrogeneDB ID: | retro_pabe_3345 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 8:75756049..75756450(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FAM213A | ||
Ensembl ID: | ENSPPYG00000025862 | ||
Aliases: | None | ||
Description: | family with sequence similarity 213, member A [Source:HGNC Symbol;Acc:28651] |
Percent Identity: | 86.76 % |
Parental protein coverage: | 58.95 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | EKNGAVIMAVRRPGCFLCREEAADLSSLKSM-LDQLGVPLYAVVKEHIRTEVKDFQPYFKGEIFLDEKKK |
..NGAVIMAVRRPGCFLC.EEAADLSSLK.M..D.LGVPLYAVVKEHIRTEVKDFQPYFK.E.FLDEKKK | |
Retrocopy | KENGAVIMAVRRPGCFLC*EEAADLSSLKPM<VDELGVPLYAVVKEHIRTEVKDFQPYFKRETFLDEKKK |
Parental | FYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGD |
FYGPQR.KMMFMGFI.LGVWY.FF.AWNGGFSGNLEGEGFIL...FVV.SG.QGILLEHREKEFGD | |
Retrocopy | FYGPQRQKMMFMGFICLGVWY-FF*AWNGGFSGNLEGEGFILREIFVVASGNQGILLEHREKEFGD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .33 RPM | 36 .66 RPM |
SRP007412_cerebellum | 0 .36 RPM | 8 .63 RPM |
SRP007412_heart | 0 .00 RPM | 7 .62 RPM |
SRP007412_kidney | 0 .00 RPM | 21 .48 RPM |
SRP007412_liver | 0 .00 RPM | 15 .52 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4076 |
Pan troglodytes | retro_ptro_2763 |
Gorilla gorilla | retro_ggor_2733 |
Macaca mulatta | retro_mmul_2351 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000000813 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000003657 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000001981 | 3 retrocopies | |
Homo sapiens | ENSG00000122378 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000013246 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000007485 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000021773 | 3 retrocopies | |
Mus musculus | ENSMUSG00000021792 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000013638 | 7 retrocopies | |
Procavia capensis | ENSPCAG00000009696 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000025862 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000002685 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000011140 | 1 retrocopy |