RetrogeneDB ID: | retro_dnov_427 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_4616:181294..181501(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS12 | ||
Ensembl ID: | ENSDNOG00000006214 | ||
Aliases: | None | ||
Description: | ribosomal protein S12 [Source:HGNC Symbol;Acc:10385] |
Percent Identity: | 85.71 % |
Parental protein coverage: | 53.03 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | KLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYFKCKK |
.LVEALCAEHQINL.KVDD.KKLGEWVGLCKIDREGKP.KV.GCSCVVVKD..K.SQA.DV.EEYFKCKK | |
Retrocopy | ELVEALCAEHQINLVKVDD-KKLGEWVGLCKIDREGKPHKVPGCSCVVVKD*DKDSQAEDVTEEYFKCKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 459 .72 RPM |
SRP012922_cerebellum | 0 .00 RPM | 187 .65 RPM |
SRP012922_heart | 0 .00 RPM | 177 .27 RPM |
SRP012922_kidney | 0 .00 RPM | 489 .27 RPM |
SRP012922_liver | 0 .00 RPM | 206 .82 RPM |
SRP012922_lung | 0 .15 RPM | 592 .11 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 224 .66 RPM |
SRP012922_spleen | 0 .11 RPM | 856 .74 RPM |