RetrogeneDB ID: | retro_ocun_878 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 16:65894345..65894573(+) | ||
| Located in intron of: | ENSOCUG00000012175 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS12 | ||
| Ensembl ID: | ENSOCUG00000001606 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S12 [Source:HGNC Symbol;Acc:10385] |
| Percent Identity: | 77.92 % |
| Parental protein coverage: | 58.33 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | LIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKID |
| LIHDGLA.GI.EA.KALDK.QAHLC.LA.N...PM.VKLVEALCAEHQIN.IKVDDNKKLGEW.GLCK.. | |
| Retrocopy | LIHDGLAGGICEANKALDKCQAHLCGLAHNQNKPMCVKLVEALCAEHQINQIKVDDNKKLGEWGGLCKTG |
| Parental | REGKPRK |
| R.G.P.K | |
| Retrocopy | R-GNPIK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .11 RPM | 110 .10 RPM |
| SRP017611_kidney | 0 .00 RPM | 373 .70 RPM |
| SRP017611_liver | 0 .00 RPM | 53 .26 RPM |