RetrogeneDB ID: | retro_fcat_449 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | A3:110696838..110696992(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFA4 | ||
Ensembl ID: | ENSFCAG00000024790 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa [Source:HGNC Symbol;Acc:7687] |
Percent Identity: | 75.93 % |
Parental protein coverage: | 63.41 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | LYVLRLALFNPDVSWDRKNNPEP-WNKLGPNDQYKFYSVNVD-YSKLKKEGPDF |
LY.L.LALF.P.V..DRK.NPEP.WNKLGP.DQY..YSVNVD.YSKLKK.GPDF | |
Retrocopy | LYILYLALFIPGVG*DRKYNPEP<WNKLGPSDQYRVYSVNVD<YSKLKKGGPDF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 125 .91 RPM |
SRP017611_kidney | 0 .00 RPM | 136 .55 RPM |
SRP017611_liver | 0 .00 RPM | 72 .68 RPM |