RetrogeneDB ID: | retro_btau_1075 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 25:33973979..33974147(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA4 | ||
| Ensembl ID: | ENSBTAG00000011145 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4 [Source:UniProtKB/Swiss-Prot;Acc:Q01321] |
| Percent Identity: | 60.71 % |
| Parental protein coverage: | 67.07 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MLRQIIGQAKRHPSLIPLFIFIGAGGTGAALYVTRLALFNPDVSWDRKNNPEP-WN |
| M......QAK.HPSLIP.F.FIGA.GTGAALYV..LALFNP..S.....NP...WN | |
| Retrocopy | MICRTVSQAKKHPSLIPFFLFIGAVGTGAALYVLHLALFNPVTSGRIIQNPRTNWN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 155 .87 RPM |
| ERP005899_muscle | 0 .00 RPM | 125 .90 RPM |
| SRP017611_brain | 0 .00 RPM | 75 .65 RPM |
| SRP017611_kidney | 0 .00 RPM | 195 .66 RPM |
| SRP017611_liver | 0 .00 RPM | 64 .94 RPM |
| SRP030211_testis | 0 .08 RPM | 24 .87 RPM |