RetrogeneDB ID: | retro_sscr_682 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 2:124346226..124346415(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFA4 | ||
Ensembl ID: | ENSSSCG00000024313 | ||
Aliases: | None | ||
Description: | Sus scrofa NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa (NDUFA4), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001097468] |
Percent Identity: | 77.78 % |
Parental protein coverage: | 76.83 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | VFIGAGGTGAALYVTRLALFNPDVCWDRKNNPEPWNKLGPNDQYKFFAVNVDYSKLKKEGPDF |
.FIGAGGT.AALYV..LALFNPD..WDRKNNPEP.NKLG..DQYKF.AV..DYSKLKKE..DF | |
Retrocopy | IFIGAGGTAAALYVMGLALFNPDISWDRKNNPEP*NKLGASDQYKFLAVHGDYSKLKKEDLDF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 58 .14 RPM |
SRP014902_testis | 0 .00 RPM | 36 .92 RPM |
SRP018288_heart | 0 .00 RPM | 841 .08 RPM |
SRP018288_kidney | 0 .00 RPM | 371 .66 RPM |
SRP018288_liver | 0 .00 RPM | 173 .98 RPM |
SRP018288_lung | 0 .00 RPM | 54 .17 RPM |
SRP018856_adipose | 0 .00 RPM | 76 .74 RPM |
SRP035408_brain | 0 .00 RPM | 162 .36 RPM |
SRP035408_liver | 0 .00 RPM | 105 .92 RPM |