RetrogeneDB ID: | retro_fcat_459 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | A3:10296901..10297115(-) | ||
Located in intron of: | ENSFCAG00000022069 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFA4 | ||
Ensembl ID: | ENSFCAG00000024790 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa [Source:HGNC Symbol;Acc:7687] |
Percent Identity: | 65.28 % |
Parental protein coverage: | 86.59 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | GQAKKHPSLIPLFIFIGAGGTGAALYVLRLALFNPDVSWDRKNNPEPWNKLGPNDQYK-FYSVNVDYSKL |
GQAKK...LIPL..F.GAGG..A.LYV..L.LFNPDVS.DR..NPEPW.K.GPN.QYK.F.SV...Y.KL | |
Retrocopy | GQAKKPQNLIPLLAFTGAGGIRAVLYVSCLGLFNPDVSRDRRSNPEPWWKRGPNGQYK>FCSVTAHYCKL |
Parental | KK |
.K | |
Retrocopy | EK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 125 .91 RPM |
SRP017611_kidney | 0 .00 RPM | 136 .55 RPM |
SRP017611_liver | 0 .00 RPM | 72 .68 RPM |