RetrogeneDB ID: | retro_mmul_1667 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 3:15007945..15008135(-) | ||
Located in intron of: | ENSMMUG00000019571 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.16850 | ||
Ensembl ID: | ENSMMUG00000019544 | ||
Aliases: | None | ||
Description: | 60S ribosomal protein L37a [Source:RefSeq peptide;Acc:NP_001252654] |
Percent Identity: | 54.41 % |
Parental protein coverage: | 72.83 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | VKKIEISQHAK-YTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ |
VKK.EISQ.AK.YTC.....TK.....V.I.HCGSCMKTVA....T.NT.S.....S...RL..LKDQ | |
Retrocopy | VKKSEISQRAK>YTCF--SLTKPR*QVVRIQHCGSCMKTVADSISTHNTSS--SSQSTL*RLEKLKDQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 18 .15 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 95 .20 RPM |
SRP007412_cerebellum | 0 .26 RPM | 22 .79 RPM |
SRP007412_heart | 0 .00 RPM | 35 .86 RPM |
SRP007412_kidney | 0 .00 RPM | 24 .76 RPM |
SRP007412_liver | 0 .00 RPM | 51 .18 RPM |
SRP007412_testis | 0 .04 RPM | 24 .58 RPM |