RetrogeneDB ID: | retro_ggor_2636 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 7:137524874..137525109(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL37A | ||
| Ensembl ID: | ENSGGOG00000014827 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 65.82 % |
| Parental protein coverage: | 84.78 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | KKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCS-FCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTT |
| ..VGIVGKY.TRYG.SL.KMVKKIEISQ.AKY.CS.FCGKTKMKR.AVG.W.CGSCMKTV.......... | |
| Retrocopy | QEVGIVGKYRTRYGVSLQKMVKKIEISQYAKYICS>FCGKTKMKR*AVGLWRCGSCMKTVTVSSCRNHIV |
| Parental | SAVTVKSAI |
| ...T..SA. | |
| Retrocopy | WTCTTTSAV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 158 .06 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 165 .87 RPM |
| SRP007412_heart | 0 .00 RPM | 136 .09 RPM |
| SRP007412_kidney | 0 .04 RPM | 363 .87 RPM |
| SRP007412_liver | 0 .00 RPM | 317 .93 RPM |
| SRP007412_testis | 0 .62 RPM | 268 .74 RPM |