RetrogeneDB ID: | retro_mmul_1931 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 5:10531331..10531681(-) | ||
Located in intron of: | ENSMMUG00000015294 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL10A | ||
Ensembl ID: | ENSMMUG00000015907 | ||
Aliases: | None | ||
Description: | 60S ribosomal protein L10a [Source:RefSeq peptide;Acc:NP_001253155] |
Percent Identity: | 81.67 % |
Parental protein coverage: | 53.92 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | VSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYD-PQKDKRFSGTVRLKSTPRPKFSVCVL-GDQQ |
VSRDTL.EAVREVLH.NQ.K..KFLETVELQISLKNYD..QKDK.FSGTVRLKSTPRPKFSVCVL...QQ | |
Retrocopy | VSRDTL*EAVREVLHRNQCKDPKFLETVELQISLKNYD>SQKDK*FSGTVRLKSTPRPKFSVCVL<ENQQ |
Parental | HCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAK-KYDAFLASESLIKQIP |
HCD..KAVDIPHM....L.KLNKN.KLVKKLAK..YDAFLASESLIK.IP | |
Retrocopy | HCDKVKAVDIPHMENKVLRKLNKNRKLVKKLAK<EYDAFLASESLIKHIP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .11 RPM | 102 .41 RPM |
SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 157 .15 RPM |
SRP007412_cerebellum | 0 .06 RPM | 96 .41 RPM |
SRP007412_heart | 0 .12 RPM | 174 .01 RPM |
SRP007412_kidney | 0 .12 RPM | 159 .15 RPM |
SRP007412_liver | 0 .00 RPM | 165 .86 RPM |
SRP007412_testis | 0 .00 RPM | 49 .11 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000000670 | 13 retrocopies | |
Echinops telfairi | ENSETEG00000013325 | 2 retrocopies | |
Felis catus | ENSFCAG00000012904 | 7 retrocopies | |
Homo sapiens | ENSG00000198755 | 13 retrocopies | |
Gorilla gorilla | ENSGGOG00000028140 | 10 retrocopies | |
Macropus eugenii | ENSMEUG00000005760 | 6 retrocopies | |
Macaca mulatta | ENSMMUG00000015907 | 6 retrocopies |
retro_mmul_1931 , retro_mmul_2041, retro_mmul_2321, retro_mmul_2330, retro_mmul_306, retro_mmul_583,
|
Monodelphis domestica | ENSMODG00000013766 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000008650 | 13 retrocopies | |
Ornithorhynchus anatinus | ENSOANG00000014574 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000004065 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000000505 | 4 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000002047 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000009431 | 6 retrocopies |