RetrogeneDB ID: | retro_mputfur_639 | ||
Retrocopy location | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL896930.1:1702494..1702743(+) | ||
| Located in intron of: | ENSMPUG00000012821 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL28 | ||
| Ensembl ID: | ENSMPUG00000007450 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L28 [Source:HGNC Symbol;Acc:10330] |
| Percent Identity: | 68.24 % |
| Parental protein coverage: | 62.04 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | PAADGKGVVVVMKRRSGQRKPATSYVRTTINKNARATLSSVRHMIRKNKYRPDLRMAAIRRASAILRSQK |
| P.A.GKGVVVVMK..S.Q.KPATSYV..T.NKNA.ATLSS..H.I.KNKY.P.L.M.A..RAS.IL.SQK | |
| Retrocopy | PMAKGKGVVVVMK*KS-Q*KPATSYVQATMNKNAWATLSSIMHVICKNKYCPVLHMDAAHRASTILHSQK |
| Parental | PVMVKRKRARPTKSS |
| P.MVK.K..R.TKSS | |
| Retrocopy | PTMVK-KENRTTKSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000015980 | 1 retrocopy | |
| Ailuropoda melanoleuca | ENSAMEG00000003764 | 15 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000869 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012833 | 2 retrocopies | |
| Felis catus | ENSFCAG00000005639 | 15 retrocopies | |
| Macropus eugenii | ENSMEUG00000015744 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000023789 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015901 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000275 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000007450 | 10 retrocopies | |
| Mus musculus | ENSMUSG00000030432 | 10 retrocopies | |
| Petromyzon marinus | ENSPMAG00000008617 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010417 | 4 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000007315 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000017127 | 5 retrocopies | |
| Sorex araneus | ENSSARG00000009741 | 1 retrocopy |