RetrogeneDB ID: | retro_rnor_1588 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 2:270752956..270753204(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RGD1565183 | ||
| Ensembl ID: | ENSRNOG00000017127 | ||
| Aliases: | None | ||
| Description: | 60S ribosomal protein L28 [Source:RefSeq peptide;Acc:NP_073188] |
| Percent Identity: | 71.43 % |
| Parental protein coverage: | 59.12 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | TVGVEPAADGKGVVVVMKRRSGQRKPATSYVRTTI-NKN-ARATLSSIRHMIRKNKYRPDLRMAAIRRAS |
| T.G...AADGKGV...MKRRSGQRKPA.SYV.TT..N.N.ARA.LSS.RH.I.K.K.RPDLRMAAIRRA. | |
| Retrocopy | TMG*STAADGKGVMEAMKRRSGQRKPAASYVSTTTTNENKARAALSSSRHVI*KKKHRPDLRMAAIRRAR |
| Parental | AILRS-QKPVVVKR |
| AIL.S...PVVVKR | |
| Retrocopy | AILQS<LEPVVVKR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 77 .58 RPM |
| SRP017611_kidney | 0 .00 RPM | 88 .41 RPM |
| SRP017611_liver | 0 .00 RPM | 59 .91 RPM |