RetrogeneDB ID: | retro_sara_699 | ||
Retrocopy location | Organism: | Shrew (Sorex araneus) | |
| Coordinates: | scaffold_260097:39677..39878(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TBCA | ||
| Ensembl ID: | ENSSARG00000009943 | ||
| Aliases: | None | ||
| Description: | tubulin folding cofactor A [Source:HGNC Symbol;Acc:11579] |
| Percent Identity: | 86.96 % |
| Parental protein coverage: | 77.53 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MKAEDGENYAIKKQAEILQESLMMIPDCQRRLEAAHTDLLQILESEKDLEEAEEYKEARSVLDSVKLEA |
| MKA.D..NYAIKKQAEILQESLM.IPDCQRR.EAA.TDL.Q.LESEKDLEEA.EYKEARSVLDSVKLEA | |
| Retrocopy | MKAGDV*NYAIKKQAEILQESLM-IPDCQRRAEAAQTDL-QTLESEKDLEEAGEYKEARSVLDSVKLEA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000014223 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000019848 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000012187 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000016572 | 1 retrocopy | |
| Homo sapiens | ENSG00000171530 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000011853 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000042043 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000010198 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000002460 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000015579 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000017013 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000048342 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000009943 | 1 retrocopy |
retro_sara_699 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000009840 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000006034 | 6 retrocopies | |
| Tarsius syrichta | ENSTSYG00000000514 | 1 retrocopy |