RetrogeneDB ID: | retro_cjac_2687 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 5:154508835..154509182(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RAC3 | ||
| Ensembl ID: | ENSCJAG00000018194 | ||
| Aliases: | None | ||
| Description: | ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) [Source:HGNC Symbol;Acc:9803] |
| Percent Identity: | 54.17 % |
| Parental protein coverage: | 56.4 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | PHLLPKDVFLICFSLVSPASFENVRAKWYPEVRHHCP-HTPILLVGTKLDLRDDKDTIERLRDKKLAPIT |
| P..L..D..L.CFSLVS.ASFENV.A.W.PE..H..P..TPI.L.G.KLDL....D..E....K.L.PIT | |
| Retrocopy | PFYL*TDRVLVCFSLVSTASFENVCAEWHPEMQHRFP<NTPIVLGGSKLDLSVVRDATEK--PKRLTPIT |
| Parental | YPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKK |
| Y.Q.L....EIG.V.YL....L..R.....FDEAI.AVLCPPPVKK...K | |
| Retrocopy | YLQFLTSGKEIGVVNYLT-AWLSHREASKLFDEAILAVLCPPPVKKR*RK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 0 .20 RPM |
| SRP051959_heart | 0 .00 RPM | 0 .25 RPM |
| SRP051959_kidney | 0 .00 RPM | 2 .82 RPM |
| SRP051959_liver | 0 .02 RPM | 11 .61 RPM |
| SRP051959_lung | 0 .00 RPM | 0 .55 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 0 .73 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 0 .11 RPM |
| SRP051959_spleen | 0 .02 RPM | 0 .25 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017364 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000000685 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000002144 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000005912 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000018194 | 1 retrocopy |
retro_cjac_2687 ,
|
| Cavia porcellus | ENSCPOG00000013861 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000012902 | 3 retrocopies | |
| Macropus eugenii | ENSMEUG00000006196 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000012467 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000009949 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000008763 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000007272 | 4 retrocopies | |
| Takifugu rubripes | ENSTRUG00000016201 | 1 retrocopy |