RetrogeneDB ID: | retro_cpor_533 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_18:37918478..37918682(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS20 | ||
Ensembl ID: | ENSCPOG00000011697 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 66.18 % |
Parental protein coverage: | 57.14 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | AFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTP |
AFKD.GKT...PEV.IHRIRI.L.S...K...K.C.DLIRGAK.KNL.VKG....PTKTLRI.TRK.P | |
Retrocopy | AFKDIGKTLMAPEVTIHRIRINLSSHKMKFMVKLCPDLIRGAKKKNLQVKGFICLPTKTLRIITRKMP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 84 .43 RPM |
SRP017611_kidney | 0 .00 RPM | 154 .94 RPM |
SRP017611_liver | 0 .00 RPM | 92 .19 RPM |
SRP040447_lung | 0 .00 RPM | 174 .78 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 186 .40 RPM |