RetrogeneDB ID: | retro_ecab_522 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 2:73895302..73895715(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS14 | ||
| Ensembl ID: | ENSECAG00000024336 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S14 [Source:HGNC Symbol;Acc:10387] |
| Percent Identity: | 62.59 % |
| Parental protein coverage: | 91.39 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | KEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESSPYAAML |
| KE.KEE.VIS...Q.AE.EN.FG.CHI..SFNDTFV.VTDLSGKETI..VT.GMK.K.D..ESS.YAAM. | |
| Retrocopy | KENKEE*VISFELQAAEEENIFGICHIVVSFNDTFVNVTDLSGKETIGCVTCGMKAKFDQNESSLYAAMS |
| Parental | AAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSALRA-LARSGMKIGRIEDVTPIPSDSTRRKG |
| A.Q.VAQR.KEL.ITAL..KL..TGGNRTK..G.GA...LRA.L..S.M.I...EDV..IP.......G | |
| Retrocopy | ATQEVAQRYKELDITALGTKLQVTGGNRTKI*GNGAHLILRA<LCQSQMNIEWTEDVLYIPGQCLQEGG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 599 .86 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 259 .40 RPM |
| SRP021940_embryo | 0 .00 RPM | 423 .13 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 279 .91 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 416 .53 RPM |
| SRP021940_testis | 0 .00 RPM | 213 .51 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004644 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000008570 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000018094 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020981 | 1 retrocopy | |
| Equus caballus | ENSECAG00000024336 | 3 retrocopies |
retro_ecab_127, retro_ecab_282, retro_ecab_522 ,
|
| Latimeria chalumnae | ENSLACG00000016164 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000031195 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000013279 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000002848 | 5 retrocopies | |
| Mustela putorius furo | ENSMPUG00000013776 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000010366 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000011509 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000000721 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000008422 | 17 retrocopies |