RetrogeneDB ID: | retro_eeur_49 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | GeneScaffold_2638:46564..46931(+) | ||
| Located in intron of: | ENSEEUG00000003747 | ||
Retrocopy information | Ensembl ID: | ENSEEUG00000003943 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HMGB2 | ||
| Ensembl ID: | ENSEEUG00000012238 | ||
| Aliases: | None | ||
| Description: | high mobility group box 2 [Source:HGNC Symbol;Acc:5000] |
| Percent Identity: | 74.8 % |
| Parental protein coverage: | 60.29 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKAR |
| MGKGDP.KPRGKMSSYAFFVQTC.EEHKKKH...SVNF.EFSKKCSE.WKTMSAKEK.KFEDMAK.DKAR | |
| Retrocopy | MGKGDPKKPRGKMSSYAFFVQTCCEEHKKKH--ASVNFSEFSKKCSEKWKTMSAKEKGKFEDMAKADKAR |
| Parental | YDREMKNY-VPPKGDKKGKKKDPNAPK-RPPSAFF-LFCSKHHPKIKSEHPGLS-HW |
| Y.REMK.Y....KG..K.K.KDP.APK...P...F.LFCS...PKIK.EHPGLS.HW | |
| Retrocopy | YEREMKTY>XXXKGETKKKFKDPKAPK>KRPLSAFFLFCSEYRPKIKGEHPGLS<HW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 14 .02 RPM | 2 .26 RPM |
| SRP017611_kidney | 18 .19 RPM | 3 .56 RPM |
| SRP017611_liver | 8 .68 RPM | 3 .70 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000015101 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000003552 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000019440 | 4 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000012238 | 8 retrocopies |
retro_eeur_118, retro_eeur_223, retro_eeur_345, retro_eeur_49 , retro_eeur_54, retro_eeur_661, retro_eeur_702, retro_eeur_86,
|
| Echinops telfairi | ENSETEG00000010379 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000016379 | 1 retrocopy | |
| Felis catus | ENSFCAG00000004218 | 2 retrocopies | |
| Homo sapiens | ENSG00000164104 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015882 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000002256 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000003527 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006662 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000015204 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000016597 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000013167 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000015650 | 1 retrocopy |