RetrogeneDB ID: | retro_cpor_604 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_2:35553498..35553844(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HMGB2 | ||
Ensembl ID: | ENSCPOG00000003552 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 66.1 % |
Parental protein coverage: | 55.45 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | GKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARY |
G...P....G..........TC.EEHKKKHPDS.VNF..FSKKC.E.W.TMSAKEK.KFED.AKSDKA.Y | |
Retrocopy | GQDRPQQTMGQXXXXXXXX*TCYEEHKKKHPDSLVNFVKFSKKCLEGWETMSAKEKLKFEDTAKSDKACY |
Parental | DREMKNYVPPKGGDKRGKKKDP-NAPKRPPSAFFLFCSEHRPKIKSEH |
D...KNY.PPK.GD.R..KK.P.NAPKRPPS.FFLFCSE..PKIKSEH | |
Retrocopy | DKVVKNYGPPKNGDER--KKFP>NAPKRPPSFFFLFCSEYCPKIKSEH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 1 .44 RPM | 6 .67 RPM |
SRP017611_kidney | 0 .73 RPM | 16 .96 RPM |
SRP017611_liver | 0 .13 RPM | 9 .10 RPM |
SRP040447_lung | 1 .31 RPM | 25 .90 RPM |
SRP040447_skeletal_muscle | 0 .25 RPM | 8 .04 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000015101 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000000601 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000003552 | 4 retrocopies | |
Cavia porcellus | ENSCPOG00000003985 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000019440 | 4 retrocopies | |
Erinaceus europaeus | ENSEEUG00000012238 | 8 retrocopies | |
Echinops telfairi | ENSETEG00000010379 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000016379 | 1 retrocopy | |
Felis catus | ENSFCAG00000004218 | 2 retrocopies | |
Homo sapiens | ENSG00000164104 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000015882 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000002256 | 3 retrocopies | |
Monodelphis domestica | ENSMODG00000003527 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000006662 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000015204 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000016597 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000013167 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000015650 | 1 retrocopy |