RetrogeneDB ID: retro_etel_1409

Retrocopy location

• Organism: Lesser hedgehog tenrec (Echinops telfairi)
• Coordinates: scaffold_261211:2626..2871(-)
• Located in intron of: None

Retrocopy information

• Ensembl ID: None
• Aliases: None
• Status: NOVEL

Parental gene information

• Parental gene symbol: BTF3L4
• Ensembl ID: ENSETEG00000011923
• Aliases: None
• Description: basic transcription factor 3-like 4 [Source:HGNC Symbol;Acc:30547]

Sequence

>retro_etel_1409
ATGACTGAAGAAAAGTTAGCCACGCTTCAGGCTCAGGTCTGGCTAGGGAGCAAGGGTACAGCTAGCAGAAAGAAGAAGGT
GGTACCTCGAACAGCCACAGCTGATGACAAAAAGCTTCAGAAGTCTCTTAAAAATTGGCTGTGAATAATATAGCTGGTAT
TGAAGAGGTAAACATGATTAGAGATGATGGAGCAGTTATTGACTTCCACAATCCCAAGGTCCAAGCCTCCCACTCTGCTA
ACACT

Alignment

ORF - retro_etel_1409 Open Reading Frame is not conserved.

Retrocopy - Parental Gene Alignment summary:

• Percent Identity: 81.93 %
• Parental protein coverage: 51.9 %
• Number of stop codons detected: 0
• Number of frameshifts detected: 1

Retrocopy - Parental Gene Alignment:

Parental  MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLK-KLAVNNIAGIEEVNMIKDDGTVIHF
          M..EKLA.LQAQV..G.KGTA.RKKKVV.RTATADDKKLQ.SLK.KLAVNNIAGIEEVNMI.DDG.VI.F
Retrocopy MTEEKLATLQAQVWLGSKGTASRKKKVVPRTATADDKKLQKSLK<KLAVNNIAGIEEVNMIRDDGAVIDF

Parental  NNPKVQASLSANT
          .NPKVQAS.SANT
Retrocopy HNPKVQASHSANT

Legend:

• *: Stop codon
• >: Forward frameshift by one nucleotide
• <: Reverse frameshift by one nucleotide

Expression

RNA-Seq

Echinops telfairi was not studied using RNA-Seq expression data.

ChIP-Seq

Echinops telfairi was not studied using ChIP-Seq data.

EST

Echinops telfairi was not studied using EST data.

TSS

Echinops telfairi was not studied using FANTOM5 data.

Lab

retro_etel_1409 was not experimentally validated.

Homology

Retrocopy orthology:

Echinops telfairi does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.

---

Parental genes homology:

Parental genes homology involve 30 parental genes, and 123 retrocopies.

Species	Parental gene accession	Retrocopies number
Bos taurus	ENSBTAG00000011025	1 retrocopy	retro_btau_1030,
Canis familiaris	ENSCAFG00000003782	2 retrocopies	retro_cfam_2135, retro_cfam_938,
Callithrix jacchus	ENSCJAG00000021582	4 retrocopies	retro_cjac_2000, retro_cjac_2929, retro_cjac_4160, retro_cjac_451,
Cavia porcellus	ENSCPOG00000004006	1 retrocopy	retro_cpor_908,
Ciona savignyi	ENSCSAVG00000009653	1 retrocopy	retro_csav_25,
Dasypus novemcinctus	ENSDNOG00000003181	4 retrocopies	retro_dnov_1690, retro_dnov_1928, retro_dnov_2672, retro_dnov_921,
Erinaceus europaeus	ENSEEUG00000004502	3 retrocopies	retro_eeur_215, retro_eeur_447, retro_eeur_456,
Echinops telfairi	ENSETEG00000011923	11 retrocopies	retro_etel_1017, retro_etel_1167, retro_etel_1207, retro_etel_1409 , retro_etel_1990, retro_etel_2113, retro_etel_2203, retro_etel_291, retro_etel_663, retro_etel_804, retro_etel_953,
Echinops telfairi	ENSETEG00000017341	5 retrocopies	retro_etel_1216, retro_etel_1394, retro_etel_1997, retro_etel_405, retro_etel_960,
Homo sapiens	ENSG00000134717	3 retrocopies	retro_hsap_2173, retro_hsap_2514, retro_hsap_3669,
Loxodonta africana	ENSLAFG00000016124	3 retrocopies	retro_lafr_206, retro_lafr_769, retro_lafr_947,
Macropus eugenii	ENSMEUG00000006135	10 retrocopies	retro_meug_1114, retro_meug_1164, retro_meug_1333, retro_meug_1395, retro_meug_1512, retro_meug_1663, retro_meug_2008, retro_meug_298, retro_meug_903, retro_meug_966,
Microcebus murinus	ENSMICG00000002807	1 retrocopy	retro_mmur_804,
Myotis lucifugus	ENSMLUG00000016884	1 retrocopy	retro_mluc_912,
Macaca mulatta	ENSMMUG00000003636	1 retrocopy	retro_mmul_59,
Monodelphis domestica	ENSMODG00000000770	2 retrocopies	retro_mdom_33, retro_mdom_992,
Mustela putorius furo	ENSMPUG00000006966	2 retrocopies	retro_mputfur_1444, retro_mputfur_924,
Mus musculus	ENSMUSG00000028568	2 retrocopies	retro_mmus_1134, retro_mmus_2743,
Nomascus leucogenys	ENSNLEG00000016041	2 retrocopies	retro_nleu_1439, retro_nleu_521,
Oryctolagus cuniculus	ENSOCUG00000001517	3 retrocopies	retro_ocun_1001, retro_ocun_1412, retro_ocun_1912,
Otolemur garnettii	ENSOGAG00000030256	2 retrocopies	retro_ogar_2759, retro_ogar_570,
Ochotona princeps	ENSOPRG00000013335	2 retrocopies	retro_opri_719, retro_opri_974,
Procavia capensis	ENSPCAG00000006428	3 retrocopies	retro_pcap_129, retro_pcap_307, retro_pcap_373,
Pongo abelii	ENSPPYG00000001353	2 retrocopies	retro_pabe_1850, retro_pabe_3010,
Pan troglodytes	ENSPTRG00000000735	3 retrocopies	retro_ptro_1459, retro_ptro_1658, retro_ptro_2489,
Rattus norvegicus	ENSRNOG00000008512	8 retrocopies	retro_rnor_1113, retro_rnor_1666, retro_rnor_1870, retro_rnor_1871, retro_rnor_1872, retro_rnor_537, retro_rnor_760, retro_rnor_998,
Sorex araneus	ENSSARG00000003173	2 retrocopies	retro_sara_680, retro_sara_690,
Ictidomys tridecemlineatus	ENSSTOG00000006129	6 retrocopies	retro_itri_1309, retro_itri_402, retro_itri_459, retro_itri_541, retro_itri_701, retro_itri_810,
Tupaia belangeri	ENSTBEG00000013307	30 retrocopies	retro_tbel_1050, retro_tbel_1052, retro_tbel_1178, retro_tbel_1595, retro_tbel_1642, retro_tbel_1785, retro_tbel_1883, retro_tbel_1924, retro_tbel_2245, retro_tbel_2290, retro_tbel_2532, retro_tbel_2979, retro_tbel_3092, retro_tbel_3100, retro_tbel_3340, retro_tbel_3469, retro_tbel_3483, retro_tbel_3520, retro_tbel_3583, retro_tbel_3598, retro_tbel_3986, retro_tbel_4045, retro_tbel_4278, retro_tbel_4283, retro_tbel_4563, retro_tbel_4623, retro_tbel_539, retro_tbel_701, retro_tbel_98, retro_tbel_991,
Tarsius syrichta	ENSTSYG00000013635	3 retrocopies	retro_tsyr_1576, retro_tsyr_1822, retro_tsyr_2045,