RetrogeneDB ID: | retro_ggor_796 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 12:47660305..47660536(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX5B | ||
Ensembl ID: | ENSGGOG00000001142 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 61.25 % |
Parental protein coverage: | 60.47 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | MASRLLRGAGTLAAQA-LRARGPSGAAAVRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNILAPKG |
MASRL...AG.LAA.A.LRA..P.G..AV..MASGGG.PTD..Q.TGLERE.M.A......P.....PKG | |
Retrocopy | MASRLIFRAGALAA*A<LRAYSPNGVVAVCFMASGGGIPTDDKQMTGLEREFMIAMYE-IGPIQYITPKG |
Parental | -ASGTREDPN |
.ASGTREDPN | |
Retrocopy | >ASGTREDPN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .10 RPM | 100 .75 RPM |
SRP007412_cerebellum | 0 .04 RPM | 67 .61 RPM |
SRP007412_heart | 0 .00 RPM | 199 .75 RPM |
SRP007412_kidney | 0 .04 RPM | 153 .66 RPM |
SRP007412_liver | 0 .00 RPM | 70 .82 RPM |
SRP007412_testis | 0 .00 RPM | 45 .69 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_997 |
Pan troglodytes | retro_ptro_754 |