RetrogeneDB ID: | retro_ecab_762 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 31:18842726..18842942(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX5B | ||
| Ensembl ID: | ENSECAG00000007968 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit Vb [Source:HGNC Symbol;Acc:2269] |
| Percent Identity: | 76.39 % |
| Parental protein coverage: | 55.81 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | PTDDEQATGLEREVLMAARKGLDPYNILAPKAASGTKEDPNLVPSITNKRIVGCICEEDNSAVIWFWLHK |
| P.DD..ATGLERE.LMAA.KGLD..N..APKAASGTKEDPNLVPS.TNK.I..CICE.DN.AV..FWLHK | |
| Retrocopy | PADDKWATGLERELLMAAQKGLDSCNTPAPKAASGTKEDPNLVPSGTNKAIASCICEKDNTAVTCFWLHK |
| Parental | GE |
| GE | |
| Retrocopy | GE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 29 .63 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 125 .31 RPM |
| SRP021940_embryo | 0 .03 RPM | 69 .71 RPM |
| SRP021940_placental_villous | 0 .05 RPM | 89 .29 RPM |
| SRP021940_synovial_membrane | 0 .03 RPM | 52 .71 RPM |
| SRP021940_testis | 0 .77 RPM | 165 .23 RPM |