RetrogeneDB ID: | retro_cfam_712 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 16:43259267..43259516(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX5B | ||
| Ensembl ID: | ENSCAFG00000002387 | ||
| Aliases: | None | ||
| Description: | Canis lupus familiaris cytochrome c oxidase polypeptide Vb (COX5B), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001144130] |
| Percent Identity: | 51.16 % |
| Parental protein coverage: | 65.62 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 2 |
| Parental | GLEREVMMAARKGLDPYNILAPKAAAGTKEDPNLVPSITNKRIVGCICEEDNS-TVIWFWLHKGEAQRCP |
| GLE.E..MA....LDP.N...PK.A.G..EDPNLVPSITNK..VGC.C.ED.S...I.F..H....Q.C. | |
| Retrocopy | GLE-EIIMAT*NELDPFNMPVPKVASGATEDPNLVPSITNKQTVGCLCGEDHS<SAI*FCWHESDTQ*CS |
| Parental | -SCGTHYKLVPHQLAH |
| ..C.THY.......AH | |
| Retrocopy | >TCVTHYRGYSTSCAH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 115 .71 RPM |
| SRP017611_brain | 0 .00 RPM | 73 .60 RPM |
| SRP017611_kidney | 0 .00 RPM | 309 .91 RPM |
| SRP017611_liver | 0 .00 RPM | 71 .79 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Sus scrofa | retro_sscr_562 |
| Equus caballus | retro_ecab_674 |