RetrogeneDB ID: | retro_ggor_2479 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 6:136747401..136747644(-) | ||
| Located in intron of: | ENSGGOG00000014471 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX5B | ||
| Ensembl ID: | ENSGGOG00000001142 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 67.9 % |
| Parental protein coverage: | 62.79 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | MASRLLRGAGTLAAQALRARGPSGAAAVRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNILAPKGA |
| M.SRLL.GAG..A..ALRA.GP.G...V.S..SGG.V..D.EQ.TGLER.IM.AA.KGLDPYNIL.PK.A | |
| Retrocopy | MPSRLL*GAGVPAVRALRAQGP*GVVEVHSNVSGGDVLIDNEQVTGLERDIMMAARKGLDPYNILPPKAA |
| Parental | SGTREDPNLVP |
| SGT.EDPNL.P | |
| Retrocopy | SGTKEDPNLAP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 100 .75 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 67 .61 RPM |
| SRP007412_heart | 0 .00 RPM | 199 .75 RPM |
| SRP007412_kidney | 0 .04 RPM | 153 .66 RPM |
| SRP007412_liver | 0 .00 RPM | 70 .82 RPM |
| SRP007412_testis | 0 .10 RPM | 45 .69 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3667 |
| Pan troglodytes | retro_ptro_2488 |