RetrogeneDB ID: | retro_ptro_754 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 12:39641368..39641599(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX5B | ||
Ensembl ID: | ENSPTRG00000012257 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase subunit Vb [Source:HGNC Symbol;Acc:2269] |
Percent Identity: | 58.75 % |
Parental protein coverage: | 60.47 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | MASRLLRGARTLAAQA-LRARGPSGAAAVRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNILAPKG |
MASRL...A..LAA.A.LRA..P.G..AV..MASGGG.PTD..Q.TGLERE.M.A......P.....PKG | |
Retrocopy | MASRLIFRAGALAA*A<LRAYSPNGVVAVCFMASGGGIPTDDKQMTGLEREFMIAMYE-IGPIQYITPKG |
Parental | -ASGTREDPN |
.AS.TREDPN | |
Retrocopy | >ASDTREDPN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 127 .57 RPM |
SRP007412_cerebellum | 0 .00 RPM | 74 .64 RPM |
SRP007412_heart | 0 .00 RPM | 285 .63 RPM |
SRP007412_kidney | 0 .00 RPM | 234 .22 RPM |
SRP007412_liver | 0 .03 RPM | 99 .94 RPM |
SRP007412_testis | 0 .11 RPM | 39 .20 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_997 |
Gorilla gorilla | retro_ggor_796 |