RetrogeneDB ID: | retro_amel_1867 | ||
Retrocopy location | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL194975.1:61214..61437(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSAMEG00000005242 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 66.23 % |
| Parental protein coverage: | 52.45 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | VFVAGVMASRLLRGVGALAAQALRARGPNGVAAVRTMASGGGVPTD-DDQATGLEREVLMAARKGLD-PY |
| .FV..VMAS.LL.G.GALA.Q.L...GPNGVA.V..MAS.G.VP...D.QATGLEREV.M.A.KGLD.P. | |
| Retrocopy | LFVVDVMASGLLCGIGALATQDLWTHGPNGVATVHSMASAGSVPME<DKQATGLEREVMMTA*KGLD<PI |
| Parental | NMLAPKA |
| NMLAP.A | |
| Retrocopy | NMLAPQA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |