RetrogeneDB ID: | retro_ocun_1639 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | GL018734:1486122..1486355(-) | ||
| Located in intron of: | ENSOCUG00000009642 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX5B | ||
| Ensembl ID: | ENSOCUG00000017085 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit Vb [Source:HGNC Symbol;Acc:2269] |
| Percent Identity: | 57.5 % |
| Parental protein coverage: | 61.24 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | EQATGLEREVMMAARK-GLDPYNMLPPKAASGTKEDPNLVPSITNKRIVGCICEEDNSAVIWFWLHKGET |
| ......ERE...A.R..GLD...MLP.KAASGT.EDP..VPS.TNK.IV.C.CE...SA..W..LH.GET | |
| Retrocopy | QEGVNAEREGTVAHRR<GLDLHSMLPRKAASGTQEDPDSVPSVTNKQIVTCHCEA-SSAITWSCLHRGET |
| Parental | QRCPNCGTHY |
| Q.CP.CGTH. | |
| Retrocopy | Q*CPGCGTHH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .28 RPM | 132 .07 RPM |
| SRP017611_kidney | 0 .20 RPM | 213 .46 RPM |
| SRP017611_liver | 0 .00 RPM | 38 .77 RPM |