RetrogeneDB ID: | retro_sscr_893 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 6:152970382..152970603(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX5B | ||
| Ensembl ID: | ENSSSCG00000008195 | ||
| Aliases: | None | ||
| Description: | Sus scrofa mitochondrial cytochrome c oxidase subunit Vb (Cox5b), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001007517] |
| Percent Identity: | 59.49 % |
| Parental protein coverage: | 58.91 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | ASRLLRGAGALAAQTLRARGPNGVAVVRS-MASGGGVPTDEEQATGLEREVMMAARK-GLDPYNILAPK- |
| ASRLL.G.GALAAQ.LRARGP.GV..V.S....G......E..ATGL...VMMA....GL.PY...APK. | |
| Retrocopy | ASRLLLGTGALAAQALRARGPDGVPAVHS>ASGGAAADEEE--ATGLGKAVMMAGAR<GLGPYRMAAPK< |
| Parental | AASGTKEDP |
| .ASGTKEDP | |
| Retrocopy | GASGTKEDP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 149 .32 RPM |
| SRP014902_testis | 0 .00 RPM | 102 .55 RPM |
| SRP018288_heart | 0 .00 RPM | 372 .13 RPM |
| SRP018288_kidney | 0 .00 RPM | 349 .01 RPM |
| SRP018288_liver | 0 .00 RPM | 156 .87 RPM |
| SRP018288_lung | 0 .00 RPM | 46 .94 RPM |
| SRP018856_adipose | 0 .02 RPM | 231 .38 RPM |
| SRP035408_brain | 0 .00 RPM | 175 .19 RPM |
| SRP035408_liver | 0 .00 RPM | 160 .17 RPM |