RetrogeneDB ID: | retro_nleu_1996 | ||
Retrocopy location | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397321.1:3888332..3888567(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBE2V1 | ||
| Ensembl ID: | ENSNLEG00000006987 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 56.96 % |
| Parental protein coverage: | 53.06 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | TRWTGMIIGPPRTIYENRIYSLKIECGPKYPEA-PPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNS |
| TRWT..I.G...TIYEN.I..LK..C.PKY.E..P......TK..MN.VNSSN.VVD.RA....AK.QN. | |
| Retrocopy | TRWTEVIVGSLQTIYENLICNLKTGCRPKYTET>PTLCNILTKNHMNEVNSSN*VVDLRAALAPAK*QN* |
| Parental | YSIKVVLQE |
| YSI.VV.QE | |
| Retrocopy | YSIGVVMQE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |