RetrogeneDB ID: | retro_pvam_1455 | ||
Retrocopy location | Organism: | Megabat (Pteropus vampyrus) | |
| Coordinates: | scaffold_91108:40..318(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | AP4S1 | ||
| Ensembl ID: | ENSPVAG00000017161 | ||
| Aliases: | None | ||
| Description: | adaptor-related protein complex 4, sigma 1 subunit [Source:HGNC Symbol;Acc:575] |
| Percent Identity: | 51.58 % |
| Parental protein coverage: | 58.86 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | EVIKSCLSRSNEQCSFIEYKDFKLVYRQYA-ALFIVVGVNDTENEMAIYEFIHNFVEVLDEYFSRVSELD |
| .V.KS.L..SN...SF.E..DFKL..R.YA.A.F.V.GV.DTENEM.IYEF.HN...V.D..FS.VSEL. | |
| Retrocopy | KVMKSNLP*SNDRRSFTECRDFKLMCRKYA>APFTVAGVDDTENEMVIYEFVHNSCQVVDNNFSQVSELN |
| Parental | -VSFNAVSQVFRSTWQTQASLDQEP |
| .V....V...F...W...A.L.Q.P | |
| Retrocopy | >VNLGKV-HIFWMRWCYMAALWQRP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000013301 | 4 retrocopies | |
| Dipodomys ordii | ENSDORG00000009468 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000013009 | 1 retrocopy | |
| Homo sapiens | ENSG00000100478 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000003198 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000003123 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017579 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015901 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000014031 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005723 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000006239 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000010218 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000017161 | 1 retrocopy |
retro_pvam_1455 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000010759 | 1 retrocopy |