RetrogeneDB ID: | retro_mdom_1774 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 7:53810676..53810950(-) | ||
Located in intron of: | ENSMODG00000000682 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | AP4S1 | ||
Ensembl ID: | ENSMODG00000017579 | ||
Aliases: | None | ||
Description: | adaptor-related protein complex 4, sigma 1 subunit [Source:HGNC Symbol;Acc:575] |
Percent Identity: | 57.45 % |
Parental protein coverage: | 63.89 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | IKTCLTRSKEQCSFIEYKDFKLIYRQYAALFIVVGINDTENEMAVYEFIHNF-VEVLDMYFSRVSELDIM |
....L..SKEQCSFI.YK.FKLIY.QY...F..V.IN...NEM..YE.IHNF...V.D..FS.V.E.D.M | |
Retrocopy | VREPLSNSKEQCSFIKYKHFKLIYWQYVTIFTMVRINKADNEMDIYESIHNF<FKVSDKGFSQVPE*DTM |
Parental | FNLDKVHII-LDEMVLNGCIVETN |
.NLD.VHII.LD..VL..C.V.TN | |
Retrocopy | INLDQVHII<LDQTVLHNCMVKTN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 20 .03 RPM |
SRP007412_cerebellum | 0 .00 RPM | 29 .71 RPM |
SRP007412_heart | 0 .00 RPM | 23 .52 RPM |
SRP007412_kidney | 0 .00 RPM | 38 .19 RPM |
SRP007412_liver | 0 .00 RPM | 36 .25 RPM |
SRP007412_testis | 0 .00 RPM | 8 .25 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000013301 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000005786 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000009468 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000013009 | 1 retrocopy | |
Homo sapiens | ENSG00000100478 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000003198 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000011671 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000003123 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017197 | 7 retrocopies | |
Monodelphis domestica | ENSMODG00000017579 | 1 retrocopy |
retro_mdom_1774 ,
|
Monodelphis domestica | ENSMODG00000021198 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000015901 | 1 retrocopy | |
Ornithorhynchus anatinus | ENSOANG00000014031 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000005723 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000006239 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000017161 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000005765 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000010759 | 1 retrocopy |