RetrogeneDB ID: | retro_pabe_2889 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 6:90002220..90002536(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | AP4S1 | ||
Ensembl ID: | ENSPPYG00000005723 | ||
Aliases: | None | ||
Description: | adaptor-related protein complex 4, sigma 1 subunit [Source:HGNC Symbol;Acc:575] |
Percent Identity: | 91.51 % |
Parental protein coverage: | 66.04 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MIKFFLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLS-RSNEQCSFIEYKDFKLIYRQYAALFIVV |
MIKFFLMVNKQGQTRL.KYYEHVDINKRTLLETEVIKSCLS.RSNEQCSFIEYKDFKL.YRQYAALF.VV | |
Retrocopy | MIKFFLMVNKQGQTRLFKYYEHVDINKRTLLETEVIKSCLS>RSNEQCSFIEYKDFKLVYRQYAALFVVV |
Parental | GVNDTENEMAIYEFIHNFVEVLDEYFSRVSELDVSF |
GVNDTEN.MAIYEFIHNFVEVLDE.FS.VSELD..F | |
Retrocopy | GVNDTENKMAIYEFIHNFVEVLDECFS*VSELDIMF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .50 RPM | 3 .43 RPM |
SRP007412_cerebellum | 0 .85 RPM | 1 .82 RPM |
SRP007412_heart | 0 .24 RPM | 0 .78 RPM |
SRP007412_kidney | 0 .03 RPM | 0 .40 RPM |
SRP007412_liver | 0 .06 RPM | 0 .31 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3496 |
Pan troglodytes | retro_ptro_2368 |
Gorilla gorilla | retro_ggor_2363 |
Macaca mulatta | retro_mmul_17 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000013301 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000005786 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000009468 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000013009 | 1 retrocopy | |
Homo sapiens | ENSG00000100478 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000003198 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000011671 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000003123 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017579 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000015901 | 1 retrocopy | |
Ornithorhynchus anatinus | ENSOANG00000014031 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000005723 | 1 retrocopy |
retro_pabe_2889 ,
|
Pan troglodytes | ENSPTRG00000006239 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000017161 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000005765 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000010759 | 1 retrocopy |