RetrogeneDB ID: | retro_pabe_2889 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 6:90002220..90002536(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | AP4S1 | ||
| Ensembl ID: | ENSPPYG00000005723 | ||
| Aliases: | None | ||
| Description: | adaptor-related protein complex 4, sigma 1 subunit [Source:HGNC Symbol;Acc:575] |
| Percent Identity: | 91.51 % |
| Parental protein coverage: | 66.04 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MIKFFLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLS-RSNEQCSFIEYKDFKLIYRQYAALFIVV |
| MIKFFLMVNKQGQTRL.KYYEHVDINKRTLLETEVIKSCLS.RSNEQCSFIEYKDFKL.YRQYAALF.VV | |
| Retrocopy | MIKFFLMVNKQGQTRLFKYYEHVDINKRTLLETEVIKSCLS>RSNEQCSFIEYKDFKLVYRQYAALFVVV |
| Parental | GVNDTENEMAIYEFIHNFVEVLDEYFSRVSELDVSF |
| GVNDTEN.MAIYEFIHNFVEVLDE.FS.VSELD..F | |
| Retrocopy | GVNDTENKMAIYEFIHNFVEVLDECFS*VSELDIMF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .50 RPM | 3 .43 RPM |
| SRP007412_cerebellum | 0 .85 RPM | 1 .82 RPM |
| SRP007412_heart | 0 .24 RPM | 0 .78 RPM |
| SRP007412_kidney | 0 .03 RPM | 0 .40 RPM |
| SRP007412_liver | 0 .06 RPM | 0 .31 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3496 |
| Pan troglodytes | retro_ptro_2368 |
| Gorilla gorilla | retro_ggor_2363 |
| Macaca mulatta | retro_mmul_17 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000013301 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000005786 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000009468 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000013009 | 1 retrocopy | |
| Homo sapiens | ENSG00000100478 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000003198 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000011671 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000003123 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017579 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015901 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000014031 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005723 | 1 retrocopy |
retro_pabe_2889 ,
|
| Pan troglodytes | ENSPTRG00000006239 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000017161 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005765 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000010759 | 1 retrocopy |